Lineage for d3rsee_ (3rse E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506852Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 1506853Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
    automatically mapped to Pfam PF04062
  5. 1506854Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)
  6. 1506862Protein automated matches [190347] (1 species)
    not a true protein
  7. 1506863Species Cow (Bos taurus) [TaxId:9913] [187174] (12 PDB entries)
  8. 1506875Domain d3rsee_: 3rse E: [185143]
    Other proteins in same PDB: d3rsea1, d3rsea2, d3rseb_, d3rsec_, d3rsed1, d3rsed2, d3rsef_, d3rseg_
    automated match to d1k8ke_

Details for d3rsee_

PDB Entry: 3rse (more details), 2.65 Å

PDB Description: Structural and biochemical characterization of two binding sites for nucleation promoting factor WASp-VCA on Arp2/3 complex
PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOPe Domain Sequences for d3rsee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rsee_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls

SCOPe Domain Coordinates for d3rsee_:

Click to download the PDB-style file with coordinates for d3rsee_.
(The format of our PDB-style files is described here.)

Timeline for d3rsee_: