SCOPe 2.04: Domain d3rkjb_: 3rkj B:

Lineage for d3rkjb_ (3rkj B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (12 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (28 PDB entries)

8. Domain d3rkjb_: 3rkj B: [200485]
   automated match to d3rkja_
   complexed with gol, so4

Details for d3rkjb_

PDB Entry: 3rkj, 2 Å

PDB Description: Crystal Structure of New Delhi Metallo-Beta-Lactamase-1 from Klebsiella pnueumoniae

PDB Compounds: (B:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3rkjb_:

Sequence; same for both SEQRES and ATOM records:

>d3rkjb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
rfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnw
ikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfa
angwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgda
dtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d3rkjb_:

• d3rkjb_ first appeared in SCOPe 2.03
  
• d3rkjb_ appears in SCOPe 2.05
  
• d3rkjb_ appears in the current release, SCOPe 2.08