Lineage for d3qlqb_ (3qlq B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1532834Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1532838Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 1532846Species Canavalia cathartica [TaxId:28958] [224859] (1 PDB entry)
  8. 1532848Domain d3qlqb_: 3qlq B: [200362]
    automated match to d1nlsa_
    complexed with ca, man, mn

Details for d3qlqb_

PDB Entry: 3qlq (more details), 1.7 Å

PDB Description: crystal structure of concanavalin a bound to an octa-alpha-mannosyl- octasilsesquioxane cluster
PDB Compounds: (B:) Concanavalin-A

SCOPe Domain Sequences for d3qlqb_:

Sequence, based on SEQRES records: (download)

>d3qlqb_ b.29.1.1 (B:) Concanavalin A {Canavalia cathartica [TaxId: 28958]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d3qlqb_ b.29.1.1 (B:) Concanavalin A {Canavalia cathartica [TaxId: 28958]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnse
tnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiw
essavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d3qlqb_:

Click to download the PDB-style file with coordinates for d3qlqb_.
(The format of our PDB-style files is described here.)

Timeline for d3qlqb_: