SCOPe 2.07: Domain d3puxf1: 3pux F:10-260

Lineage for d3puxf1 (3pux F:10-260)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.70: MalF N-terminal region-like [160963] (1 superfamily)
   consists of 3 N-terminal transmembrane helices, an alpha+beta linker domain and a beta-barrel (n=7; S=8) with one overside loop

4. Superfamily e.70.1: MalF N-terminal region-like [160964] (1 family)

5. Family e.70.1.1: MalF N-terminal region-like [160965] (1 protein)
   PfamB PB001917

6. Protein Maltose transport system permease protein MalF [160966] (1 species)

7. Species Escherichia coli [TaxId:562] [160967] (10 PDB entries)
   Uniprot P02916 13-260

8. Domain d3puxf1: 3pux F:10-260 [200247]
   Other proteins in same PDB: d3puxa1, d3puxa2, d3puxa3, d3puxb1, d3puxb2, d3puxe1, d3puxe2, d3puxf2, d3puxg_
   automated match to d2r6gf1
   complexed with adp, bef, mal, mg, pgv, umq

Details for d3puxf1

PDB Entry: 3pux, 2.3 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3

PDB Compounds: (F:) Maltose transport system permease protein malF

SCOPe Domain Sequences for d3puxf1:

Sequence, based on SEQRES records:

>d3puxf1 e.70.1.1 (F:10-260) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wqsdalkwsvlgllgllvgylvvlmyaqgeylfaittlilssaglyifanrkayawryvy
pgmagmglfvlfplvctiaiaftnysstnqltferaqevlldrswqagktynfglypagd
ewqlalsdgetgknylsdafkfggeqklqlkettaqpegeranlrvitqnrqalsditai
lpdgnkvmmsslrqfsgtqplytldgdgtltnnqsgvkyrpnnqigfyqsitadgnwgde
klspgytvttg

Sequence, based on observed residues (ATOM records):

>d3puxf1 e.70.1.1 (F:10-260) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wqsdalkwsvlgllgllvgylvvlmyaqgeylfaittlilssaglyifanrkayawryvy
pgmagmglfvlfplvctiaiaftnysstnqltferaqevlldrswqagktynfglypagd
ewqlalsdgetgknylsdafkfggeqklqlkettaqpegeranlrvitqnrqalsditai
lpdgnkvmmsslrqfsgtqplytldgdgtltnnqsgvkyrpnnqigfyqsinwgdeklsp
gytvttg

Timeline for d3puxf1:

• d3puxf1 first appeared in SCOPe 2.03
  
• d3puxf1 appears in SCOPe 2.06
  
• d3puxf1 appears in the current release, SCOPe 2.08