SCOPe 2.07: Domain d3puxf2: 3pux F:261-503

Lineage for d3puxf2 (3pux F:261-503)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.58: MetI-like [161097] (1 superfamily)
   core: 5 transmembrane helices; flattened bundle

4. Superfamily f.58.1: MetI-like [161098] (1 family)

5. Family f.58.1.1: MetI-like [161099] (6 proteins)
   Pfam PF00528; Binding-protein-dependent transport system inner membrane component

6. Protein Maltose transport system permease protein MalF [161106] (1 species)

7. Species Escherichia coli [TaxId:562] [161107] (10 PDB entries)
   Uniprot P02916 261-504

8. Domain d3puxf2: 3pux F:261-503 [200248]
   Other proteins in same PDB: d3puxa1, d3puxa2, d3puxa3, d3puxb1, d3puxb2, d3puxe1, d3puxe2, d3puxf1, d3puxg_
   automated match to d2r6gf2
   complexed with adp, bef, mal, mg, pgv, umq

Details for d3puxf2

PDB Entry: 3pux, 2.3 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3

PDB Compounds: (F:) Maltose transport system permease protein malF

SCOPe Domain Sequences for d3puxf2:

Sequence; same for both SEQRES and ATOM records:

>d3puxf2 f.58.1.1 (F:261-503) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wknftrvftdegiqkpflaifvwtvvfslitvfltvavgmvlaclvqwealrgkavyrvl
lilpyavpsfisilifkglfnqsfgeinmmlsalfgvkpawfsdpttartmliivntwlg
ypymmilcmgllkaipddlyeasamdgagpfqnffkitlpllikpltplmiasfafnfnn
fvliqlltnggpdrlgtttpagytdllvnytyriafeggggqdfglaaaiatlifllvga
lai

Timeline for d3puxf2:

• d3puxf2 first appeared in SCOPe 2.03
  
• d3puxf2 appears in SCOPe 2.06
  
• d3puxf2 appears in the current release, SCOPe 2.08