Lineage for d3potd2 (3pot D:270-549)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496760Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 1496761Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 1496823Family a.89.1.0: automated matches [227272] (1 protein)
    not a true family
  6. 1496824Protein automated matches [227075] (2 species)
    not a true protein
  7. 1496825Species Methanothermobacter marburgensis [TaxId:145263] [226796] (1 PDB entry)
  8. 1496828Domain d3potd2: 3pot D:270-549 [200221]
    Other proteins in same PDB: d3pota1, d3potb1, d3potc_, d3potd1, d3pote1, d3potf_
    automated match to d1e6va1
    complexed with 06c, com, edo, f43, k, mg, tp7, txz

Details for d3potd2

PDB Entry: 3pot (more details), 1.2 Å

PDB Description: structural analysis of a ni(iii)-methyl species in methyl-coenzyme m reductase from methanothermobacter marburgensis
PDB Compounds: (D:) Methyl-coenzyme M reductase I subunit alpha

SCOPe Domain Sequences for d3potd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3potd2 a.89.1.0 (D:270-549) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

SCOPe Domain Coordinates for d3potd2:

Click to download the PDB-style file with coordinates for d3potd2.
(The format of our PDB-style files is described here.)

Timeline for d3potd2: