Lineage for d3pota1 (3pot A:2-269)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1654623Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1654718Family d.58.31.0: automated matches [227271] (1 protein)
    not a true family
  6. 1654719Protein automated matches [227074] (2 species)
    not a true protein
  7. 1654720Species Methanothermobacter marburgensis [TaxId:145263] [226795] (1 PDB entry)
  8. 1654721Domain d3pota1: 3pot A:2-269 [200216]
    Other proteins in same PDB: d3pota2, d3potb2, d3potc_, d3potd2, d3pote2, d3potf_
    automated match to d1e6va2
    complexed with 06c, com, edo, f43, k, mg, tp7, txz

Details for d3pota1

PDB Entry: 3pot (more details), 1.2 Å

PDB Description: structural analysis of a ni(iii)-methyl species in methyl-coenzyme m reductase from methanothermobacter marburgensis
PDB Compounds: (A:) Methyl-coenzyme M reductase I subunit alpha

SCOPe Domain Sequences for d3pota1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pota1 d.58.31.0 (A:2-269) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOPe Domain Coordinates for d3pota1:

Click to download the PDB-style file with coordinates for d3pota1.
(The format of our PDB-style files is described here.)

Timeline for d3pota1: