| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily) multihelical bundle; contains buried central helix |
Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) ![]() |
| Family a.89.1.0: automated matches [227272] (1 protein) not a true family |
| Protein automated matches [227075] (2 species) not a true protein |
| Species Methanothermobacter marburgensis [TaxId:145263] [226796] (1 PDB entry) |
| Domain d3potb2: 3pot B:189-443 [200219] Other proteins in same PDB: d3pota1, d3potb1, d3potc_, d3potd1, d3pote1, d3potf_ automated match to d1e6vb1 complexed with 06c, com, edo, f43, k, mg, tp7, txz |
PDB Entry: 3pot (more details), 1.2 Å
SCOPe Domain Sequences for d3potb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3potb2 a.89.1.0 (B:189-443) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei
Timeline for d3potb2: