SCOPe 2.08: Domain d3potb2: 3pot B:189-443

Lineage for d3potb2 (3pot B:189-443)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.0: automated matches [227272] (1 protein)
   not a true family

6. Protein automated matches [227075] (6 species)
   not a true protein

7. Species Methanothermobacter marburgensis [TaxId:145263] [226796] (1 PDB entry)

8. Domain d3potb2: 3pot B:189-443 [200219]
   Other proteins in same PDB: d3pota1, d3potb1, d3potc_, d3potd1, d3pote1, d3potf_
   automated match to d1e6vb1
   complexed with 06c, com, edo, f43, k, mg, tp7, txz

Details for d3potb2

PDB Entry: 3pot, 1.2 Å

PDB Description: structural analysis of a ni(iii)-methyl species in methyl-coenzyme m reductase from methanothermobacter marburgensis

PDB Compounds: (B:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d3potb2:

Sequence; same for both SEQRES and ATOM records:

>d3potb2 a.89.1.0 (B:189-443) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

Timeline for d3potb2:

• d3potb2 first appeared in SCOPe 2.03
  
• d3potb2 appears in SCOPe 2.07