Lineage for d3orhd_ (3orh D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501068Family c.66.1.16: Guanidinoacetate methyltransferase [69550] (1 protein)
  6. 2501069Protein Guanidinoacetate methyltransferase [69551] (2 species)
    a template structure of protein arginine methyltransferase
  7. 2501070Species Human (Homo sapiens) [TaxId:9606] [142580] (2 PDB entries)
    Uniprot Q14353 8-236
  8. 2501074Domain d3orhd_: 3orh D: [200156]
    automated match to d3orha_
    complexed with sah

Details for d3orhd_

PDB Entry: 3orh (more details), 1.86 Å

PDB Description: Human guanidinoacetate N-methyltransferase with SAH
PDB Compounds: (D:) Guanidinoacetate N-methyltransferase

SCOPe Domain Sequences for d3orhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3orhd_ c.66.1.16 (D:) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
pawgaapaaydaadthlrilgkpvmerwetpymhalaaaasskggrvlevgfgmaiaask
vqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedvaptlpdghfdgilydty
plseetwhthqfnfiknhafrllkpggvltycnltswgelmkskysditimfeetqvpal
leagfrrenirtevmalvppadcryyafpqmitplvtkg

SCOPe Domain Coordinates for d3orhd_:

Click to download the PDB-style file with coordinates for d3orhd_.
(The format of our PDB-style files is described here.)

Timeline for d3orhd_: