Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.16: Guanidinoacetate methyltransferase [69550] (1 protein) |
Protein Guanidinoacetate methyltransferase [69551] (2 species) a template structure of protein arginine methyltransferase |
Species Human (Homo sapiens) [TaxId:9606] [142580] (2 PDB entries) Uniprot Q14353 8-236 |
Domain d3orhd_: 3orh D: [200156] automated match to d3orha_ complexed with sah |
PDB Entry: 3orh (more details), 1.86 Å
SCOPe Domain Sequences for d3orhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3orhd_ c.66.1.16 (D:) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} pawgaapaaydaadthlrilgkpvmerwetpymhalaaaasskggrvlevgfgmaiaask vqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedvaptlpdghfdgilydty plseetwhthqfnfiknhafrllkpggvltycnltswgelmkskysditimfeetqvpal leagfrrenirtevmalvppadcryyafpqmitplvtkg
Timeline for d3orhd_: