PDB entry 3orh

View 3orh on RCSB PDB site
Description: Human guanidinoacetate N-methyltransferase with SAH
Class: transferase
Keywords: GUANIDINOACETATE N-METHYLTRANSFERASE, TRANSFERASE, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2010-09-07, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.209
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanidinoacetate N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GAMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3orha_
  • Chain 'B':
    Compound: Guanidinoacetate N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GAMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3orhb_
  • Chain 'C':
    Compound: Guanidinoacetate N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GAMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3orhc_
  • Chain 'D':
    Compound: Guanidinoacetate N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GAMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3orhd_
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3orhA (A:)
    msapsatpifapgencspawgaapaaydaadthlrilgkpvmerwetpymhalaaaassk
    ggrvlevgfgmaiaaskvqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedv
    aptlpdghfdgilydtyplseetwhthqfnfiknhafrllkpggvltycnltswgelmks
    kysditimfeetqvpalleagfrrenirtevmalvppadcryyafpqmitplvtkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3orhA (A:)
    tpifapgencspawgaapaaydaadthlrilgkpvmerwetpymhalaaaasskggrvle
    vgfgmaiaaskvqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedvaptlpd
    ghfdgilydtyplseetwhthqfnfiknhafrllkpggvltycnltswgelmkskysdit
    imfeetqvpalleagfrrenirtevmalvppadcryyafpqmitplvtkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3orhB (B:)
    msapsatpifapgencspawgaapaaydaadthlrilgkpvmerwetpymhalaaaassk
    ggrvlevgfgmaiaaskvqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedv
    aptlpdghfdgilydtyplseetwhthqfnfiknhafrllkpggvltycnltswgelmks
    kysditimfeetqvpalleagfrrenirtevmalvppadcryyafpqmitplvtkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3orhB (B:)
    pifapgencspawgaapaaydaadthlrilgkpvmerwetpymhalaaaasskggrvlev
    gfgmaiaaskvqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedvaptlpdg
    hfdgilydtyplseetwhthqfnfiknhafrllkpggvltycnltswgelmkskysditi
    mfeetqvpalleagfrrenirtevmalvppadcryyafpqmitplvtkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3orhC (C:)
    msapsatpifapgencspawgaapaaydaadthlrilgkpvmerwetpymhalaaaassk
    ggrvlevgfgmaiaaskvqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedv
    aptlpdghfdgilydtyplseetwhthqfnfiknhafrllkpggvltycnltswgelmks
    kysditimfeetqvpalleagfrrenirtevmalvppadcryyafpqmitplvtkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3orhC (C:)
    tpifapgencspawgaapaaydaadthlrilgkpvmerwetpymhalaaaasskggrvle
    vgfgmaiaaskvqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedvaptlpd
    ghfdgilydtyplseetwhthqfnfiknhafrllkpggvltycnltswgelmkskysdit
    imfeetqvpalleagfrrenirtevmalvppadcryyafpqmitplvtkg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3orhD (D:)
    msapsatpifapgencspawgaapaaydaadthlrilgkpvmerwetpymhalaaaassk
    ggrvlevgfgmaiaaskvqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedv
    aptlpdghfdgilydtyplseetwhthqfnfiknhafrllkpggvltycnltswgelmks
    kysditimfeetqvpalleagfrrenirtevmalvppadcryyafpqmitplvtkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3orhD (D:)
    pawgaapaaydaadthlrilgkpvmerwetpymhalaaaasskggrvlevgfgmaiaask
    vqeapidehwiiecndgvfqrlrdwaprqthkviplkglwedvaptlpdghfdgilydty
    plseetwhthqfnfiknhafrllkpggvltycnltswgelmkskysditimfeetqvpal
    leagfrrenirtevmalvppadcryyafpqmitplvtkg