Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d3oj2c2: 3oj2 C:251-359 [200092] Other proteins in same PDB: d3oj2a_, d3oj2b_, d3oj2c1, d3oj2d1 automated match to d1ev2g2 complexed with so4; mutant |
PDB Entry: 3oj2 (more details), 2.2 Å
SCOPe Domain Sequences for d3oj2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oj2c2 b.1.1.0 (C:251-359) automated matches {Human (Homo sapiens) [TaxId: 9606]} rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk vlkhsginssnaevlalfnvteadageyickvsnyigqanqsawltvlp
Timeline for d3oj2c2:
View in 3D Domains from other chains: (mouse over for more information) d3oj2a_, d3oj2b_, d3oj2d1, d3oj2d2 |