![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein automated matches [190803] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries) |
![]() | Domain d3oj2c1: 3oj2 C:151-250 [200091] Other proteins in same PDB: d3oj2a_, d3oj2b_, d3oj2c2, d3oj2d2 automated match to d1ev2g1 complexed with so4; mutant |
PDB Entry: 3oj2 (more details), 2.2 Å
SCOPe Domain Sequences for d3oj2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oj2c1 b.1.1.4 (C:151-250) automated matches {Human (Homo sapiens) [TaxId: 9606]} krapywtntekmekrlhavpafntvkfrcpaggnpmptmrwlkngkefkqehriggykvr nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve
Timeline for d3oj2c1:
![]() Domains from other chains: (mouse over for more information) d3oj2a_, d3oj2b_, d3oj2d1, d3oj2d2 |