Lineage for d3oj2d2 (3oj2 D:251-359)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755851Domain d3oj2d2: 3oj2 D:251-359 [200094]
    Other proteins in same PDB: d3oj2a_, d3oj2b_, d3oj2c1, d3oj2d1
    automated match to d1ev2g2
    complexed with so4; mutant

Details for d3oj2d2

PDB Entry: 3oj2 (more details), 2.2 Å

PDB Description: Crystal structure of FGF1 complexed with the ectodomain of FGFR2b harboring the A172F Pfeiffer syndrome mutation
PDB Compounds: (D:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3oj2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oj2d2 b.1.1.0 (D:251-359) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkhsginssnaevlalfnvteadageyickvsnyigqanqsawltvlp

SCOPe Domain Coordinates for d3oj2d2:

Click to download the PDB-style file with coordinates for d3oj2d2.
(The format of our PDB-style files is described here.)

Timeline for d3oj2d2: