Lineage for d3oica1 (3oic A:3-250)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094430Species Bacillus subtilis [TaxId:1423] [196388] (11 PDB entries)
  8. 2094444Domain d3oica1: 3oic A:3-250 [200088]
    Other proteins in same PDB: d3oica2, d3oicd2
    automated match to d3oicd_
    complexed with so4

Details for d3oica1

PDB Entry: 3oic (more details), 2.2 Å

PDB Description: Crystal Structure of Enoyl-ACP Reductases III (FabL) from B. subtilis (apo form)
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADPH]

SCOPe Domain Sequences for d3oica1:

Sequence, based on SEQRES records: (download)

>d3oica1 c.2.1.0 (A:3-250) automated matches {Bacillus subtilis [TaxId: 1423]}
qnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkan
vgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaq
eaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnav
sggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiiv
dggrsllv

Sequence, based on observed residues (ATOM records): (download)

>d3oica1 c.2.1.0 (A:3-250) automated matches {Bacillus subtilis [TaxId: 1423]}
qnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkan
vgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaq
eaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnav
sggaifpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiivdggrsll
v

SCOPe Domain Coordinates for d3oica1:

Click to download the PDB-style file with coordinates for d3oica1.
(The format of our PDB-style files is described here.)

Timeline for d3oica1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3oica2