![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries) |
![]() | Domain d3oica1: 3oic A:3-250 [200088] Other proteins in same PDB: d3oica2, d3oicd2 automated match to d3oicd_ complexed with so4 |
PDB Entry: 3oic (more details), 2.2 Å
SCOPe Domain Sequences for d3oica1:
Sequence, based on SEQRES records: (download)
>d3oica1 c.2.1.0 (A:3-250) automated matches {Bacillus subtilis [TaxId: 1423]} qnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkan vgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaq eaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnav sggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiiv dggrsllv
>d3oica1 c.2.1.0 (A:3-250) automated matches {Bacillus subtilis [TaxId: 1423]} qnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkan vgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaq eaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnav sggaifpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiivdggrsll v
Timeline for d3oica1: