PDB entry 3oic
View 3oic on RCSB PDB site
Description: Crystal Structure of Enoyl-ACP Reductases III (FabL) from B. subtilis (apo form)
Class: oxidoreductase
Keywords: Fatty acid synthesis, Enoyl-ACP Reductases, FabL, Rossmann-like fold, NADPH binding, Oxidoreductase
Deposited on
2010-08-19, released
2011-01-05
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-02-16, with a file datestamp of
2011-02-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Enoyl-[acyl-carrier-protein] reductase [NADPH]
Species: Bacillus subtilis [TaxId:1423]
Gene: FabL
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3oica1, d3oica2 - Chain 'D':
Compound: Enoyl-[acyl-carrier-protein] reductase [NADPH]
Species: Bacillus subtilis [TaxId:1423]
Gene: FabL
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3oicd1, d3oicd2 - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3oicA (A:)
meqnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvk
anvgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfc
aqeaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivn
avsggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqti
ivdggrsllvlehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>3oicA (A:)
qnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkan
vgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaq
eaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnav
sggaifpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiivdggrsll
vlehhhh
- Chain 'D':
Sequence, based on SEQRES records: (download)
>3oicD (D:)
meqnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvk
anvgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfc
aqeaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivn
avsggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqti
ivdggrsllvlehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>3oicD (D:)
nkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkanv
gqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaqe
aaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnavs
ggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiivd
ggrsllvlehhh