PDB entry 3oic

View 3oic on RCSB PDB site
Description: Crystal Structure of Enoyl-ACP Reductases III (FabL) from B. subtilis (apo form)
Class: oxidoreductase
Keywords: Fatty acid synthesis, Enoyl-ACP Reductases, FabL, Rossmann-like fold, NADPH binding, Oxidoreductase
Deposited on 2010-08-19, released 2011-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADPH]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: FabL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71079 (Start-249)
      • expression tag (250-255)
    Domains in SCOPe 2.07: d3oica1, d3oica2
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADPH]
    Species: Bacillus subtilis [TaxId:1423]
    Gene: FabL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71079 (Start-249)
      • expression tag (250-254)
    Domains in SCOPe 2.07: d3oicd1, d3oicd2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oicA (A:)
    meqnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvk
    anvgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfc
    aqeaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivn
    avsggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqti
    ivdggrsllvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oicA (A:)
    qnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkan
    vgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaq
    eaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnav
    sggaifpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiivdggrsll
    vlehhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oicD (D:)
    meqnkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvk
    anvgqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfc
    aqeaaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivn
    avsggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqti
    ivdggrsllvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oicD (D:)
    nkcalvtgssrgvgkaaairlaengynivinyarskkaaletaeeieklgvkvlvvkanv
    gqpakikemfqqidetfgrldvfvnnaasgvlrpvmeleethwdwtmninakallfcaqe
    aaklmeknggghivsisslgsirylenyttvgvskaalealtrylavelspkqiivnavs
    ggaidtdalkhfpnredlledarqntpagrmveikdmvdtveflvsskadmirgqtiivd
    ggrsllvlehhh