SCOPe 2.08: Domain d3oev2_: 3oev 2:

Lineage for d3oev2_ (3oev 2:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3oev2_: 3oev 2: [200065]
   Other proteins in same PDB: d3oevb_, d3oevd_, d3oevf_, d3oevp_, d3oevr_, d3oevt_
   automated match to d1g0un_
   complexed with 3oe, mes, mg

Details for d3oev2_

PDB Entry: 3oev, 2.85 Å

PDB Description: Structure of yeast 20S open-gate proteasome with Compound 25

PDB Compounds: (2:) Proteasome component PRE3

SCOPe Domain Sequences for d3oev2_:

Sequence; same for both SEQRES and ATOM records:

>d3oev2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

Timeline for d3oev2_:

• d3oev2_ first appeared in SCOPe 2.03
  
• d3oev2_ appears in SCOPe 2.07