Lineage for d3oeii_ (3oei I:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688830Fold d.306: YefM-like [143119] (1 superfamily)
    core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;
  4. 1688831Superfamily d.306.1: YefM-like [143120] (2 families) (S)
  5. 1688845Family d.306.1.0: automated matches [191570] (1 protein)
    not a true family
  6. 1688846Protein automated matches [190989] (1 species)
    not a true protein
  7. 1688847Species Mycobacterium tuberculosis [TaxId:1773] [188691] (3 PDB entries)
  8. 1688856Domain d3oeii_: 3oei I: [200039]
    Other proteins in same PDB: d3oeic_, d3oeid_, d3oeig_, d3oeih_, d3oeik_, d3oeil_, d3oeio_, d3oeip_
    automated match to d3oeia_
    complexed with flc

Details for d3oeii_

PDB Entry: 3oei (more details), 2.15 Å

PDB Description: crystal structure of mycobacterium tuberculosis reljk (rv3357-rv3358- relbe3)
PDB Compounds: (I:) RelJ (Antitoxin Rv3357)

SCOPe Domain Sequences for d3oeii_:

Sequence, based on SEQRES records: (download)

>d3oeii_ d.306.1.0 (I:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sisasearqrlfplieqvntdhqpvritsragdavlmsaddydawqetvyllrspenarr
lmeavardkaghsaftksvdelremag

Sequence, based on observed residues (ATOM records): (download)

>d3oeii_ d.306.1.0 (I:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sisasearqrlfplieqvntdhqpvritsragdavlmsaddydawqetvyllrspenarr
lmeavardkaftksvdelremag

SCOPe Domain Coordinates for d3oeii_:

Click to download the PDB-style file with coordinates for d3oeii_.
(The format of our PDB-style files is described here.)

Timeline for d3oeii_: