Lineage for d3oeih_ (3oei H:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688581Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 1688582Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 1688614Family d.298.1.0: automated matches [191658] (1 protein)
    not a true family
  6. 1688615Protein automated matches [191236] (5 species)
    not a true protein
  7. 1688631Species Mycobacterium tuberculosis [TaxId:1773] [189667] (1 PDB entry)
  8. 1688635Domain d3oeih_: 3oei H: [182963]
    Other proteins in same PDB: d3oeia_, d3oeib_, d3oeie_, d3oeif_, d3oeii_, d3oeij_, d3oeim_, d3oein_
    automated match to d2a6qe1
    complexed with flc

Details for d3oeih_

PDB Entry: 3oei (more details), 2.15 Å

PDB Description: crystal structure of mycobacterium tuberculosis reljk (rv3357-rv3358- relbe3)
PDB Compounds: (H:) RelK (Toxin Rv3358)

SCOPe Domain Sequences for d3oeih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeih_ d.298.1.0 (H:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vrsvnfdpdawedflfwlaadrktarritrligeiqrdpfsgigkpeplqgelsgywsrr
iddehrlvyragddevtmlkaryhy

SCOPe Domain Coordinates for d3oeih_:

Click to download the PDB-style file with coordinates for d3oeih_.
(The format of our PDB-style files is described here.)

Timeline for d3oeih_: