SCOPe 2.08: Domain d3o9ba_: 3o9b A:

Lineage for d3o9ba_ (3o9b A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)

8. Domain d3o9ba_: 3o9b A: [200023]
   automated match to d2f3ka_
   complexed with act, gol, k2a, po4

Details for d3o9ba_

PDB Entry: 3o9b, 1.5 Å

PDB Description: crystal structure of wild-type hiv-1 protease in complex with kd25

PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d3o9ba_:

Sequence; same for both SEQRES and ATOM records:

>d3o9ba_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d3o9ba_:

• d3o9ba_ first appeared in SCOPe 2.03
  
• d3o9ba_ appears in SCOPe 2.07