SCOPe 2.04: Domain d3o5wb2: 3o5w B:385-510

Lineage for d3o5wb2 (3o5w B:385-510)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein automated matches [190608] (3 species)
   not a true protein

7. Species European mistletoe (Viscum album) [TaxId:3972] [225471] (5 PDB entries)

8. Domain d3o5wb2: 3o5w B:385-510 [200013]
   Other proteins in same PDB: d3o5wa_
   automated match to d1oqlb2
   complexed with gol, h35, nag, so4

Details for d3o5wb2

PDB Entry: 3o5w, 2.7 Å

PDB Description: binding of kinetin in the active site of mistletoe lectin i

PDB Compounds: (B:) Beta-galactoside-specific lectin 1 chain B

SCOPe Domain Sequences for d3o5wb2:

Sequence; same for both SEQRES and ATOM records:

>d3o5wb2 b.42.2.1 (B:385-510) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfrdlcmesnggsvwvetcvasqqnqrwalygdgsirpkqnqsqcltcgrd
svstvinivscsagssgqrwvftnegailnlknglamdvaqanpslqriiiypatgkpnq
mwlpvp

Timeline for d3o5wb2:

• d3o5wb2 first appeared in SCOPe 2.03
  
• d3o5wb2 appears in SCOPe 2.05
  
• d3o5wb2 appears in the current release, SCOPe 2.08