Lineage for d3npsc2 (3nps C:108-212)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2029220Domain d3npsc2: 3nps C:108-212 [199959]
    Other proteins in same PDB: d3npsa_, d3npsc1
    automated match to d3fcta2
    complexed with cl, edo, na

Details for d3npsc2

PDB Entry: 3nps (more details), 1.5 Å

PDB Description: crystal structure of membrane-type serine protease 1 (mt-sp1) in complex with the fab inhibitor s4
PDB Compounds: (C:) s4 fab light chain

SCOPe Domain Sequences for d3npsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3npsc2 b.1.1.2 (C:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d3npsc2:

Click to download the PDB-style file with coordinates for d3npsc2.
(The format of our PDB-style files is described here.)

Timeline for d3npsc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3npsc1
View in 3D
Domains from other chains:
(mouse over for more information)
d3npsa_