Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d3npsc2: 3nps C:108-212 [199959] Other proteins in same PDB: d3npsa_, d3npsb_, d3npsc1 automated match to d3fcta2 complexed with cl, edo, na |
PDB Entry: 3nps (more details), 1.5 Å
SCOPe Domain Sequences for d3npsc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3npsc2 b.1.1.2 (C:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d3npsc2: