SCOPe 2.08: Domain d3niff1: 3nif F:1-107

Lineage for d3niff1 (3nif F:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3niff1: 3nif F:1-107 [199949]
   Other proteins in same PDB: d3nifa_, d3nifc_, d3nife_, d3niff2, d3nifh_, d3nifl2
   automated match to d1dqdl1
   complexed with ca, gol, mg, nag, nif, so4

Details for d3niff1

PDB Entry: 3nif, 2.4 Å

PDB Description: the closed headpiece of integrin iib 3 and its complex with an iib 3 - specific antagonist that does not induce opening

PDB Compounds: (F:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d3niff1:

Sequence; same for both SEQRES and ATOM records:

>d3niff1 b.1.1.0 (F:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

Timeline for d3niff1:

• d3niff1 first appeared in SCOPe 2.03
  
• d3niff1 appears in SCOPe 2.07