SCOPe 2.08: Domain d3nifl2: 3nif L:108-214

Lineage for d3nifl2 (3nif L:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3nifl2: 3nif L:108-214 [199952]
   Other proteins in same PDB: d3nifa_, d3nifc_, d3nife_, d3niff1, d3nifh_, d3nifl1
   automated match to d1dqdl2
   complexed with ca, gol, mg, nag, nif, so4

Details for d3nifl2

PDB Entry: 3nif, 2.4 Å

PDB Description: the closed headpiece of integrin iib 3 and its complex with an iib 3 - specific antagonist that does not induce opening

PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d3nifl2:

Sequence; same for both SEQRES and ATOM records:

>d3nifl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3nifl2:

• d3nifl2 first appeared in SCOPe 2.03
  
• d3nifl2 appears in SCOPe 2.07