Lineage for d3niff1 (3nif F:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1296974Domain d3niff1: 3nif F:1-107 [199949]
    Other proteins in same PDB: d3nifa_, d3nifc_, d3niff2, d3nifl2
    automated match to d1dqdl1
    complexed with ca, gol, mg, nag, nif, so4

Details for d3niff1

PDB Entry: 3nif (more details), 2.4 Å

PDB Description: the closed headpiece of integrin iib 3 and its complex with an iib 3 - specific antagonist that does not induce opening
PDB Compounds: (F:) Mmonoclonal antibody 10E5 light chain

SCOPe Domain Sequences for d3niff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3niff1 b.1.1.0 (F:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

SCOPe Domain Coordinates for d3niff1:

Click to download the PDB-style file with coordinates for d3niff1.
(The format of our PDB-style files is described here.)

Timeline for d3niff1: