Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Domain d3mt6p_: 3mt6 P: [199887] automated match to d3mt6g_ complexed with mpd |
PDB Entry: 3mt6 (more details), 1.9 Å
SCOPe Domain Sequences for d3mt6p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mt6p_ c.14.1.1 (P:) automated matches {Escherichia coli K-12 [TaxId: 83333]} lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave yglvdsilth
Timeline for d3mt6p_: