SCOPe 2.04: Domain d3mqka1: 3mqk A:11-251

Lineage for d3mqka1 (3mqk A:11-251)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.0: automated matches [227299] (1 protein)
   not a true family

6. Protein automated matches [227125] (2 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [226771] (2 PDB entries)

8. Domain d3mqka1: 3mqk A:11-251 [199869]
   Other proteins in same PDB: d3mqka2, d3mqkb_, d3mqkc_
   automated match to d2apoa2
   protein/RNA complex

Details for d3mqka1

PDB Entry: 3mqk, 2.8 Å

PDB Description: Cbf5-Nop10-Gar1 complex binding with 17mer RNA containing ACA trinucleotide

PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d3mqka1:

Sequence; same for both SEQRES and ATOM records:

>d3mqka1 d.265.1.0 (A:11-251) automated matches {Pyrococcus furiosus [TaxId: 2261]}
rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi
glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav
e

Timeline for d3mqka1:

• d3mqka1 first appeared in SCOPe 2.03
  
• d3mqka1 appears in SCOPe 2.05
  
• d3mqka1 appears in the current release, SCOPe 2.08