Lineage for d3mqka1 (3mqk A:11-251)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009172Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 3009173Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 3009243Family d.265.1.0: automated matches [227299] (1 protein)
    not a true family
  6. 3009244Protein automated matches [227125] (2 species)
    not a true protein
  7. 3009248Species Pyrococcus furiosus [TaxId:2261] [226771] (2 PDB entries)
  8. 3009249Domain d3mqka1: 3mqk A:11-251 [199869]
    Other proteins in same PDB: d3mqka2, d3mqkb_, d3mqkc_
    automated match to d2apoa2
    protein/RNA complex

Details for d3mqka1

PDB Entry: 3mqk (more details), 2.8 Å

PDB Description: Cbf5-Nop10-Gar1 complex binding with 17mer RNA containing ACA trinucleotide
PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d3mqka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mqka1 d.265.1.0 (A:11-251) automated matches {Pyrococcus furiosus [TaxId: 2261]}
rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi
glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav
e

SCOPe Domain Coordinates for d3mqka1:

Click to download the PDB-style file with coordinates for d3mqka1.
(The format of our PDB-style files is described here.)

Timeline for d3mqka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mqka2