| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
| Protein automated matches [190509] (14 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (14 PDB entries) |
| Domain d3mg8d_: 3mg8 D: [199846] Other proteins in same PDB: d3mg81_, d3mg82_, d3mg8a_, d3mg8b_, d3mg8c_, d3mg8e_, d3mg8f_, d3mg8g_, d3mg8h_, d3mg8i_, d3mg8j_, d3mg8k_, d3mg8l_, d3mg8m_, d3mg8n_, d3mg8o_, d3mg8p_, d3mg8q_, d3mg8s_, d3mg8t_, d3mg8u_, d3mg8v_, d3mg8w_, d3mg8x_, d3mg8y_, d3mg8z_ automated match to d4eu2f_ complexed with l3t, mes, mg |
PDB Entry: 3mg8 (more details), 2.59 Å
SCOPe Domain Sequences for d3mg8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mg8d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae
Timeline for d3mg8d_:
View in 3DDomains from other chains: (mouse over for more information) d3mg81_, d3mg82_, d3mg8a_, d3mg8b_, d3mg8c_, d3mg8e_, d3mg8f_, d3mg8g_, d3mg8h_, d3mg8i_, d3mg8j_, d3mg8k_, d3mg8l_, d3mg8m_, d3mg8n_, d3mg8o_, d3mg8p_, d3mg8q_, d3mg8r_, d3mg8s_, d3mg8t_, d3mg8u_, d3mg8v_, d3mg8w_, d3mg8x_, d3mg8y_, d3mg8z_ |