SCOPe 2.08: Domain d3mg8d_: 3mg8 D:

Lineage for d3mg8d_ (3mg8 D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)

8. Domain d3mg8d_: 3mg8 D: [199846]
   Other proteins in same PDB: d3mg81_, d3mg82_, d3mg8a_, d3mg8b_, d3mg8c_, d3mg8e_, d3mg8f_, d3mg8g_, d3mg8h_, d3mg8i_, d3mg8j_, d3mg8k_, d3mg8l_, d3mg8m_, d3mg8n_, d3mg8o_, d3mg8p_, d3mg8q_, d3mg8s_, d3mg8t_, d3mg8u_, d3mg8v_, d3mg8w_, d3mg8x_, d3mg8y_, d3mg8z_
   automated match to d4eu2f_
   complexed with l3t, mes, mg

Details for d3mg8d_

PDB Entry: 3mg8, 2.59 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 16

PDB Compounds: (D:) Proteasome component PUP2

SCOPe Domain Sequences for d3mg8d_:

Sequence; same for both SEQRES and ATOM records:

>d3mg8d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Timeline for d3mg8d_:

• d3mg8d_ first appeared in SCOPe 2.03
  
• d3mg8d_ appears in SCOPe 2.07