SCOPe 2.08: Domain d3lzfl2: 3lzf L:108-211

Lineage for d3lzfl2 (3lzf L:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3lzfl2: 3lzf L:108-211 [199766]
   Other proteins in same PDB: d3lzfa_, d3lzfb_, d3lzfh_, d3lzfl1
   automated match to d1jvka2
   complexed with nag

Details for d3lzfl2

PDB Entry: 3lzf, 2.8 Å

PDB Description: crystal structure of fab 2d1 in complex with the 1918 influenza virus hemagglutinin

PDB Compounds: (L:) 2D1 Fab, Light Chain

SCOPe Domain Sequences for d3lzfl2:

Sequence; same for both SEQRES and ATOM records:

>d3lzfl2 b.1.1.2 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvap

Timeline for d3lzfl2:

• d3lzfl2 first appeared in SCOPe 2.03
  
• d3lzfl2 appears in SCOPe 2.07