![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (29 species) not a true protein |
![]() | Species Influenza A virus [TaxId:59375] [255946] (2 PDB entries) |
![]() | Domain d3lzfb_: 3lzf B: [239437] Other proteins in same PDB: d3lzfa_, d3lzfh_, d3lzfl1, d3lzfl2 automated match to d4n5zb_ complexed with nag |
PDB Entry: 3lzf (more details), 2.8 Å
SCOPe Domain Sequences for d3lzfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lzfb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 59375]} glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreei
Timeline for d3lzfb_:
![]() Domains from other chains: (mouse over for more information) d3lzfa_, d3lzfh_, d3lzfl1, d3lzfl2 |