Lineage for d3lzfa_ (3lzf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775850Domain d3lzfa_: 3lzf A: [180662]
    Other proteins in same PDB: d3lzfb_, d3lzfh_, d3lzfl1, d3lzfl2
    automated match to d1rd8a_
    complexed with nag

Details for d3lzfa_

PDB Entry: 3lzf (more details), 2.8 Å

PDB Description: crystal structure of fab 2d1 in complex with the 1918 influenza virus hemagglutinin
PDB Compounds: (A:) Hemagglutinin, HA1 SUBUNIT

SCOPe Domain Sequences for d3lzfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lzfa_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdti
tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
gecpkyvrstklrmatglrnips

SCOPe Domain Coordinates for d3lzfa_:

Click to download the PDB-style file with coordinates for d3lzfa_.
(The format of our PDB-style files is described here.)

Timeline for d3lzfa_: