Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest |
Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) |
Family c.140.1.0: automated matches [191555] (1 protein) not a true family |
Protein automated matches [190957] (7 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188566] (4 PDB entries) |
Domain d3kzlc1: 3kzl C:1-263 [199688] Other proteins in same PDB: d3kzla2, d3kzlb2, d3kzlc2, d3kzld2 automated match to d3kzld_ complexed with aco, cl, epe, mg; mutant |
PDB Entry: 3kzl (more details), 2.1 Å
SCOPe Domain Sequences for d3kzlc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kzlc1 c.140.1.0 (C:1-263) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevit eegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrty pnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsnt svglsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgki gnakcrlmkqrdivdfgtewfrk
Timeline for d3kzlc1: