SCOPe 2.06: Domain d3kzlc1: 3kzl C:1-263

Lineage for d3kzlc1 (3kzl C:1-263)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest

4. Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families)

5. Family c.140.1.0: automated matches [191555] (1 protein)
   not a true family

6. Protein automated matches [190957] (4 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188566] (4 PDB entries)

8. Domain d3kzlc1: 3kzl C:1-263 [199688]
   Other proteins in same PDB: d3kzla2, d3kzlb2, d3kzlc2, d3kzld2
   automated match to d3kzld_
   complexed with aco, cl, epe, mg; mutant

Details for d3kzlc1

PDB Entry: 3kzl, 2.1 Å

PDB Description: crystal structure of ba2930 mutant (h183g) in complex with accoa

PDB Compounds: (C:) Aminoglycoside N3-acetyltransferase

SCOPe Domain Sequences for d3kzlc1:

Sequence; same for both SEQRES and ATOM records:

>d3kzlc1 c.140.1.0 (C:1-263) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevit
eegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrty
pnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsnt
svglsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgki
gnakcrlmkqrdivdfgtewfrk

Timeline for d3kzlc1:

• d3kzlc1 first appeared in SCOPe 2.03, called d3kzlc_
  
• d3kzlc1 was called d3kzlc_ in SCOPe 2.05
  
• d3kzlc1 appears in SCOPe 2.07
  
• d3kzlc1 appears in the current release, SCOPe 2.08