Lineage for d1jhlh_ (1jhl H:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158434Species Fv D11.15 (mouse), kappa L chain [48786] (1 PDB entry)
  8. 158435Domain d1jhlh_: 1jhl H: [19967]
    Other proteins in same PDB: d1jhla_

Details for d1jhlh_

PDB Entry: 1jhl (more details), 2.4 Å

PDB Description: three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex

SCOP Domain Sequences for d1jhlh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhlh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fv D11.15 (mouse), kappa L chain}
qvqlqqsgaelvrpgasvklsckasgytfisywinwvkqrpgqglewigniypsdsytny
nqkfkdkatltvdkssstaymqlssptsedsavyyctrddnygamdywgqgttvtv

SCOP Domain Coordinates for d1jhlh_:

Click to download the PDB-style file with coordinates for d1jhlh_.
(The format of our PDB-style files is described here.)

Timeline for d1jhlh_: