Lineage for d1jhlh1 (1jhl H:9-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740220Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2740317Domain d1jhlh1: 1jhl H:9-116 [19967]
    Other proteins in same PDB: d1jhla_, d1jhlh2, d1jhll_
    part of Fv D11.15

Details for d1jhlh1

PDB Entry: 1jhl (more details), 2.4 Å

PDB Description: three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex
PDB Compounds: (H:) igg1-kappa d11.15 fv (heavy chain)

SCOPe Domain Sequences for d1jhlh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhlh1 b.1.1.1 (H:9-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
aelvrpgasvklsckasgytfisywinwvkqrpgqglewigniypsdsytnynqkfkdka
tltvdkssstaymqlssptsedsavyyctrddnygamdywgqgttvtv

SCOPe Domain Coordinates for d1jhlh1:

Click to download the PDB-style file with coordinates for d1jhlh1.
(The format of our PDB-style files is described here.)

Timeline for d1jhlh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jhlh2