PDB entry 1jhl

View 1jhl on RCSB PDB site
Description: three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex
Class: complex(antibody-antigen)
Keywords: complex(antibody-antigen)
Deposited on 1993-05-04, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.214
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheasant egg white lysozyme
    Species: Phasianus colchicus [TaxId:9054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00702 (0-128)
      • conflict (102)
    Domains in SCOPe 2.07: d1jhla_
  • Chain 'H':
    Compound: igg1-kappa d11.15 fv (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JHL (0-115)
    Domains in SCOPe 2.07: d1jhlh1, d1jhlh2
  • Chain 'L':
    Compound: igg1-kappa d11.15 fv (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA38772 (0-107)
      • conflict (1-3)
      • conflict (11)
      • conflict (13)
      • conflict (31)
      • conflict (44)
      • conflict (64)
      • conflict (86)
    Domains in SCOPe 2.07: d1jhll_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jhlA (A:)
    kvygrcelaaamkrmgldnyrgyslgnwvcaakfesnfntgatnrntdgstdygilqins
    rwwcndgrtpgsknlchipcsallssditasvncakkivsdgdgmnawvawrkhckgtdv
    nvwirgcrl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jhlH (H:)
    qvqlqqsgaelvrpgasvklsckasgytfisywinwvkqrpgqglewigniypsdsytny
    nqkfkdkatltvdkssstaymqlssptsedsavyyctrddnygamdywgqgttvtv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jhlL (L:)
    dieltqspsylvaspgetitincrasksiskslawyqekpgktnnlliysgstlqsgips
    rfsgsgsgtdftltisslepedfamyicqqhneypwtfgggtkleikr