Lineage for d3kqga1 (3kqg A:199-327)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608505Domain d3kqga1: 3kqg A:199-327 [199661]
    Other proteins in same PDB: d3kqga2, d3kqgb2, d3kqgc2, d3kqgd2, d3kqge2, d3kqgf2
    complexed with ca

Details for d3kqga1

PDB Entry: 3kqg (more details), 2.3 Å

PDB Description: trimeric structure of langerin
PDB Compounds: (A:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3kqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kqga1 d.169.1.0 (A:199-327) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltka
gmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfi
ckrpyvpse

SCOPe Domain Coordinates for d3kqga1:

Click to download the PDB-style file with coordinates for d3kqga1.
(The format of our PDB-style files is described here.)

Timeline for d3kqga1: