Lineage for d1a7qh1 (1a7q H:206-316)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2344816Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2345610Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 2345622Domain d1a7qh1: 1a7q H:206-316 [19955]
    Other proteins in same PDB: d1a7qh2, d1a7ql_
    part of Fv D1.3

Details for d1a7qh1

PDB Entry: 1a7q (more details), 2 Å

PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) high affinity expressed variant containing ser26l->gly, ile29l->thr, glu81l->asp, thr97l->ser, pro240h->leu, asp258h->ala, lys281h->glu, asn283h->asp and leu312h->val
PDB Compounds: (H:) igg1-kappa d1.3 fv (heavy chain)

SCOPe Domain Sequences for d1a7qh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7qh1 b.1.1.1 (H:206-316) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
esgpglvapsqslsitctvsgfsltgygvnwvrqlpgkglewlgmiwgdgntaynsalks
rlsiskdnsksqvflemdslhtddtaryycarerdyrldywgqgttvtvss

SCOPe Domain Coordinates for d1a7qh1:

Click to download the PDB-style file with coordinates for d1a7qh1.
(The format of our PDB-style files is described here.)

Timeline for d1a7qh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a7qh2
View in 3D
Domains from other chains:
(mouse over for more information)
d1a7ql_