SCOPe 2.08: Domain d1a7qh1: 1a7q H:206-316

Lineage for d1a7qh1 (1a7q H:206-316)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)

8. Domain d1a7qh1: 1a7q H:206-316 [19955]
   Other proteins in same PDB: d1a7qh2, d1a7ql_
   part of Fv D1.3

Details for d1a7qh1

PDB Entry: 1a7q, 2 Å

PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) high affinity expressed variant containing ser26l->gly, ile29l->thr, glu81l->asp, thr97l->ser, pro240h->leu, asp258h->ala, lys281h->glu, asn283h->asp and leu312h->val

PDB Compounds: (H:) igg1-kappa d1.3 fv (heavy chain)

SCOPe Domain Sequences for d1a7qh1:

Sequence; same for both SEQRES and ATOM records:

>d1a7qh1 b.1.1.1 (H:206-316) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
esgpglvapsqslsitctvsgfsltgygvnwvrqlpgkglewlgmiwgdgntaynsalks
rlsiskdnsksqvflemdslhtddtaryycarerdyrldywgqgttvtvss

Timeline for d1a7qh1:

• d1a7qh1 first appeared (with stable ids) in SCOP 1.55, called d1a7qh_
  
• d1a7qh1 appears in SCOPe 2.07