PDB entry 1a7q

View 1a7q on RCSB PDB site
Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) high affinity expressed variant containing ser26l->gly, ile29l->thr, glu81l->asp, thr97l->ser, pro240h->leu, asp258h->ala, lys281h->glu, asn283h->asp and leu312h->val
Class: immunoglobulin
Keywords: immunoglobulin, variant
Deposited on 1998-03-16, released 1998-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: igg1-kappa d1.3 fv (heavy chain)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • GB AAA69766 (0-115)
    • somatic variant (39)
    • somatic variant (57)
    • somatic variant (80)
    • somatic variant (82)
  Domains in SCOPe 2.08: d1a7qh1, d1a7qh2
• Chain 'L':
  Compound: igg1-kappa d1.3 fv (light chain)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • GB AAB30177 (0-105)
    • conflict (2)
    • somatic variant (25)
    • somatic variant (28)
    • conflict (49-51)
    • conflict (55)
    • variant (80)
    • conflict (95)
    • somatic variant (96)
  Domains in SCOPe 2.08: d1a7ql_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a7qH (H:)
  qvqlqesgpglvapsqslsitctvsgfsltgygvnwvrqlpgkglewlgmiwgdgntayn
  salksrlsiskdnsksqvflemdslhtddtaryycarerdyrldywgqgttvtvss
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a7qL (L:)
  divltqspaslsasvgetvtitcraggnthnylawyqqkqgkspqllvyytttlaagvps
  rfsgsgsgtqyslkinslqpddfgsyycqhfwstprsfgggtklei