![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
![]() | Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) ![]() the active site is the most conserved structural region of the superfamily and is located between the subdomains |
![]() | Family d.265.1.0: automated matches [227299] (1 protein) not a true family |
![]() | Protein automated matches [227125] (2 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [226771] (2 PDB entries) |
![]() | Domain d3hjwa1: 3hjw A:11-251 [199516] Other proteins in same PDB: d3hjwa2, d3hjwb_ automated match to d2apoa2 protein/RNA complex; complexed with k, zn |
PDB Entry: 3hjw (more details), 2.35 Å
SCOPe Domain Sequences for d3hjwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hjwa1 d.265.1.0 (A:11-251) automated matches {Pyrococcus furiosus [TaxId: 2261]} rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav e
Timeline for d3hjwa1: