SCOPe 2.08: Domain d3hjwa1: 3hjw A:11-251

Lineage for d3hjwa1 (3hjw A:11-251)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.0: automated matches [227299] (1 protein)
   not a true family

6. Protein automated matches [227125] (2 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [226771] (2 PDB entries)

8. Domain d3hjwa1: 3hjw A:11-251 [199516]
   Other proteins in same PDB: d3hjwa2, d3hjwb_
   automated match to d2apoa2
   protein/RNA complex; complexed with k, zn

Details for d3hjwa1

PDB Entry: 3hjw, 2.35 Å

PDB Description: structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna

PDB Compounds: (A:) Pseudouridine synthase Cbf5

SCOPe Domain Sequences for d3hjwa1:

Sequence; same for both SEQRES and ATOM records:

>d3hjwa1 d.265.1.0 (A:11-251) automated matches {Pyrococcus furiosus [TaxId: 2261]}
rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi
glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav
e

Timeline for d3hjwa1:

• d3hjwa1 first appeared in SCOPe 2.03
  
• d3hjwa1 appears in SCOPe 2.07