| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
| Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
| Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species) |
| Species Paracoccus denitrificans [TaxId:266] [81456] (4 PDB entries) |
| Domain d3hb3b1: 3hb3 B:1-107 [199493] Other proteins in same PDB: d3hb3a_, d3hb3b2, d3hb3c_, d3hb3d_ automated match to d1ar1b2 complexed with ca, cu1, hea, lda, lmt, mn, peo |
PDB Entry: 3hb3 (more details), 2.25 Å
SCOPe Domain Sequences for d3hb3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hb3b1 f.17.2.1 (B:1-107) Bacterial aa3 type cytochrome c oxidase subunit II {Paracoccus denitrificans [TaxId: 266]}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp
Timeline for d3hb3b1: