Lineage for d3hb3b2 (3hb3 B:108-252)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036810Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 protein domains)
  6. 2036811Protein Cytochrome c oxidase [49544] (4 species)
  7. 2036865Species Paracoccus denitrificans [TaxId:266] [49546] (4 PDB entries)
  8. 2036867Domain d3hb3b2: 3hb3 B:108-252 [199494]
    Other proteins in same PDB: d3hb3a_, d3hb3b1, d3hb3c_, d3hb3d_
    automated match to d1ar1b1
    complexed with ca, cu1, hea, lda, lmt, mn, peo

Details for d3hb3b2

PDB Entry: 3hb3 (more details), 2.25 Å

PDB Description: High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3hb3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hb3b2 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaa

SCOPe Domain Coordinates for d3hb3b2:

Click to download the PDB-style file with coordinates for d3hb3b2.
(The format of our PDB-style files is described here.)

Timeline for d3hb3b2: