Lineage for d3gswa1 (3gsw A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938555Protein automated matches [191280] (6 species)
    not a true protein
  7. 2938568Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)
  8. 2938573Domain d3gswa1: 3gsw A:1-181 [199463]
    Other proteins in same PDB: d3gswa2, d3gswb1, d3gswb2
    automated match to d1x7qa2

Details for d3gswa1

PDB Entry: 3gsw (more details), 1.81 Å

PDB Description: crystal structure of the binary complex between hla-a2 and hcmv nlv- t8a peptide variant
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3gswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gswa1 d.19.1.1 (A:1-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3gswa1:

Click to download the PDB-style file with coordinates for d3gswa1.
(The format of our PDB-style files is described here.)

Timeline for d3gswa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gswa2