Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries) |
Domain d3gsra1: 3gsr A:1-181 [199457] Other proteins in same PDB: d3gsra2, d3gsrb1, d3gsrb2 automated match to d1x7qa2 |
PDB Entry: 3gsr (more details), 1.95 Å
SCOPe Domain Sequences for d3gsra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gsra1 d.19.1.1 (A:1-181) automated matches {Human (Homo sapiens) [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d3gsra1: