Lineage for d3dxkd1 (3dxk D:1-120)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685231Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1685314Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1685315Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)
  6. 1685316Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 1685317Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries)
    Uniprot O15144 1-282 # 100% sequence identity
  8. 1685338Domain d3dxkd1: 3dxk D:1-120 [199306]
    Other proteins in same PDB: d3dxka1, d3dxka2, d3dxkb_, d3dxkc_, d3dxke_, d3dxkf_, d3dxkg_
    automated match to d1k8kd1
    complexed with n23

Details for d3dxkd1

PDB Entry: 3dxk (more details), 2.7 Å

PDB Description: Structure of Bos Taurus Arp2/3 Complex with Bound Inhibitor CK0944636
PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOPe Domain Sequences for d3dxkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxkd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

SCOPe Domain Coordinates for d3dxkd1:

Click to download the PDB-style file with coordinates for d3dxkd1.
(The format of our PDB-style files is described here.)

Timeline for d3dxkd1: