Lineage for d3dxkb_ (3dxk B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605234Protein Actin-related protein 2, Arp2 [69530] (1 species)
    part of Arp2/3 complex
  7. 1605235Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
    Uniprot P61160 143-350 # 100% sequence identity
  8. 1605244Domain d3dxkb_: 3dxk B: [199305]
    Other proteins in same PDB: d3dxka1, d3dxka2, d3dxkc_, d3dxkd1, d3dxkd2, d3dxke_, d3dxkf_, d3dxkg_
    automated match to d1u2vb1
    complexed with n23

Details for d3dxkb_

PDB Entry: 3dxk (more details), 2.7 Å

PDB Description: Structure of Bos Taurus Arp2/3 Complex with Bound Inhibitor CK0944636
PDB Compounds: (B:) Actin-related Protein 2

SCOPe Domain Sequences for d3dxkb_:

Sequence, based on SEQRES records: (download)

>d3dxkb_ c.55.1.1 (B:) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
qavltlyaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllr
gyafnhsadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfe
apealfqphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlere
lkqlylervlkgdveklskfkiriedpprrkh

Sequence, based on observed residues (ATOM records): (download)

>d3dxkb_ c.55.1.1 (B:) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
qavltlyaqgllgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrg
yafnhsadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfea
pealfqphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerel
kqlylervlkgdveklskfkiriedpprrkh

SCOPe Domain Coordinates for d3dxkb_:

Click to download the PDB-style file with coordinates for d3dxkb_.
(The format of our PDB-style files is described here.)

Timeline for d3dxkb_: